>3ha6_B mol:protein length:44  Targeting protein for Xklp2
GMSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN
>3ha6_A mol:protein length:268  Serine/threonine-protein kinase 6
GKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREV
EIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELA
NALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL
ISRLLKHNPSQRPMLREVLEHPWITANSSKPS
>3ha6_B mol:protein length:44  Targeting protein for Xklp2
GMSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN