>3hcm_A mol:protein length:92  Protein S100-B
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVME
TLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE