>3hm5_A mol:protein length:93  DNA methyltransferase 1-associated protein 1
GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRY
DHQQFKKRSVEDLKERYYHICAKLANVRAVPGTD
>3hm5_A mol:protein length:93  DNA methyltransferase 1-associated protein 1
GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRY
DHQQFKKRSVEDLKERYYHICAKLANVRAVPGTD