>3hot_C mol:na length:25  Mos1 NTS inverted repeat DNA
GGTGTACAAGTAUGAAATGTCGTTT
>3hot_A mol:protein length:345  Transposable element mariner, complete cds
MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFD
VDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGR
WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKRKKSYVDPGQP
ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPE
YQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHAL
AEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
>3hot_G mol:na length:25  Mos1 NTS inverted repeat DNA
GGTGTACAAGTAUGAAATGTCGTTT
>3hot_B mol:protein length:345  Transposable element mariner, complete cds
MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFD
VDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGR
WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKRKKSYVDPGQP
ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPE
YQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHAL
AEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
>3hot_H mol:na length:28  Mos1 TS inverted repeat DNA
AAACGACATTTCATACTTGTACACCTGA
>3hot_H mol:na length:28  Mos1 TS inverted repeat DNA
AAACGACATTTCATACTTGTACACCTGA
>3hot_E mol:na length:25  Mos1 NTS inverted repeat DNA
GGTGTACAAGTAUGAAATGTCGTTT
>3hot_D mol:na length:28  Mos1 TS inverted repeat DNA
AAACGACATTTCATACTTGTACACCTGA
>3hot_F mol:na length:28  Mos1 TS inverted repeat DNA
AAACGACATTTCATACTTGTACACCTGA