>3hot_B mol:protein length:345  Transposable element mariner, complete cds
MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFD
VDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGR
WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKRKKSYVDPGQP
ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPE
YQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHAL
AEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE