>3hr4_C mol:protein length:219  Nitric oxide synthase, inducible
HHHHHHDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAW
DLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKE
LNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWA
VQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDS