>3hro_A mol:protein length:44  Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2), also called Polycystin-2 or polycystic kidney disease 2(PKD2)
GSHMGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMER