>3i5d_A mol:protein length:356  P2X purinoceptor
GSSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGE
RIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDAR
GDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENFTVLIKNNIRYPKFN
FNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIR
WDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGI
RFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVD
DF