>3ie7_A mol:protein length:320  Lin2199 protein
MSLIYTITLNPAIDRLLFIRGELEKRKTNRVIKTEFDCGGKGLHVSGVLSKFGIKNEAL
GIAGSDNLDKLYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGSTMIPEAGFTVSQT
NKDNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVKATGAFLGCDNSGEYLNL
AVEMGVDFIKPNEDEVIAILDEKTNSLEENIRTLAEKIPYLVVSLGAKGSICAHNGKLY
QVIPPKVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASKVMQQDSSSFDLE
AAGKLKNQVSIIQLEEREGHHHHHH