>3ifs_A mol:protein length:453  Glucose-6-phosphate isomerase
SNAMSTHVTFDYSKALSFIGEHEITYLRDAVKVTHHAIHEKTGAGNDFLGWVDLPLQYD
KEEFARIQKCAEKIKNDSDILLVVGIGGSYLGARAAIEMLNHSFYNTLSKEQRKTPQVL
FVGQNISSTYMKDLMDVLEGKDFSINVISKSGTTTEPALAFRIFRKLLEEKYGKEEARK
RIYATTDKARGALKTLADNEGYETFVIPDDVGGRFSVLTPVGLLPIAVSGLNIEEMMKG
AAAGRDDFGTSELEENPAYQYAVVRNALYNKGKTIEMLINYEPALQYFAEWWKQLFGES
EGKDQKGIFPSSANFSTDLHSLGQYVQEGRRDLFETVLKVGKSTHELTIESEENDLDGL
NYLAGETVDFVNTKAYEGTLLAHSDGGVPNLIVNIPELNEYTFGYLVYFFEKACAMSGY
LLGVNPFDQPGVEAYKKNMFALLGKPGFEELKAELEERLK