>3ikh_A mol:protein length:299  Carbohydrate kinase
MSLRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLI
AATGNDSNGAWIRQQIKNEPLMLLPDGHFNQHSDTSIILNSADGDNAIITTTAAADTFS
LDEMIPHMADAVAGDILLQQGNFSLDKTRALFQYARSRGMTTVFNPSPVNPDFCHLWPL
IDIAVVNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTF
LAVMLASALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGAEGHH
HHHH