>3it8_A mol:protein length:161  Tumor necrosis factor
MGSHHHHHHRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGL
YLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPW
YEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL