>3it8_E mol:protein length:324  2L protein
ITLKYNYTVTLKDDGLYDGVFYDHYNDQLVTKISYNHETRHGNVNFRADWFNISRSPHT
PGNDYNFNFWYSLMKETLEEINKNDSTKTTSLSLITGCYETGLLFGSYGYVETANGPLA
RYHTGDKRFTKMTHKGFPKVGMLTVKNTLWKDVKAYLGGFEYMGCSLAILDYQKMAKGK
IPKDTTPTVKVTGNELEDGNMTLECTVNSFYPPDVITKWIESEHFKGEYKYVNGRYYPE
WGRKSNYEPGEPGFPWNIKKDKDANTYSLTDLVRTTSKMSSQPVCVVFHDTLEAQVYTC
SEGCNGELYDHLYRKTEEGEGGSHHHHHH