>3iy9_B mol:protein length:136  39S ribosomal protein L2, mitochondrial
VIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPL
GALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCVAT
VGRVSNVDHNKRVIGKAG