>3iy9_G mol:protein length:145  39S ribosomal protein L11, mitochondrial
KPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKIL
VKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAF
ALQDVPLSSVVRSIIGSARSLGIRVVK