>3iy9_H mol:protein length:60  50S ribosomal protein L9
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLA
E