>3j7y_q mol:protein length:222  CRIF1
MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAK
QFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRRERE
QHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQE
LLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS