>3j9x_f mol:protein length:128  coat protein
SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQ
YGITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNI
ITGSPTGYVS