>3jcr_4 mol:protein length:139  LSm4
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPEC
YIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRG
GIPGTGRGQPEKKPGRQAGKQ