>3jcr_5 mol:protein length:91  LSm5
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEI
TPEGRRITKLDQILLNGNNITMLVPGGEGPEV