>3jcr_8 mol:protein length:96  LSm8
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGL
YIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH