>3jcr_s mol:protein length:92  SmE
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLD
DAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN