>3jcr_t mol:protein length:86  SmF
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHL
GEVLIRCNNVLYIRGVEEEEEDGEMRE