>3jrq_A mol:protein length:326  Protein phosphatase 2C 56
MGSSHHHHHHSSGLVPRGSHMSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDG
RFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKAL
FNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHK
PDREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKED
DCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSA
AEYLSKLAIQRGSKDNISVVVVDLKPRRKLK