>3jrv_E mol:protein length:20  ATP-dependent RNA helicase DDX3X
SFGSRSDSRGKSSFFSDRGS
>3jrv_C mol:protein length:20  ATP-dependent RNA helicase DDX3X
SFGSRSDSRGKSSFFSDRGS
>3jrv_A mol:protein length:149  Protein K7
MATKLDYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMK
FDDVAIRYYGIDKINEIVEAMSEGDHYINFTKVHDQESLFATIGICAKITEHWGYKKIS
ESRFQSLGNITDLMTDDNINILILFLEKKLN
>3jrv_B mol:protein length:149  Protein K7
MATKLDYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMK
FDDVAIRYYGIDKINEIVEAMSEGDHYINFTKVHDQESLFATIGICAKITEHWGYKKIS
ESRFQSLGNITDLMTDDNINILILFLEKKLN
>3jrv_E mol:protein length:20  ATP-dependent RNA helicase DDX3X
SFGSRSDSRGKSSFFSDRGS
>3jrv_D mol:protein length:20  ATP-dependent RNA helicase DDX3X
SFGSRSDSRGKSSFFSDRGS