>3k0j_A mol:protein length:96  U1 small nuclear ribonucleoprotein A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
>3k0j_F mol:na length:87  RNA (87-MER)
GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAU
CUGGAUAAUGCCAGCGUAGGGAAGUCGC
>3k0j_E mol:na length:87  RNA (87-MER)
GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAU
CUGGAUAAUGCCAGCGUAGGGAAGUCGC
>3k0j_C mol:protein length:96  U1 small nuclear ribonucleoprotein A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
>3k0j_B mol:protein length:96  U1 small nuclear ribonucleoprotein A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
>3k0j_D mol:protein length:96  U1 small nuclear ribonucleoprotein A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
>3k0j_F mol:na length:87  RNA (87-MER)
GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAU
CUGGAUAAUGCCAGCGUAGGGAAGUCGC