>3k0w_A mol:protein length:218  Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2
MGSSHHHHHHSSGLVPRGSKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEI
PNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESK
LQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQ
GTYWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQ
>3k0w_A mol:protein length:218  Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2
MGSSHHHHHHSSGLVPRGSKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEI
PNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESK
LQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQ
GTYWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQ