>3klt_D mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK
>3klt_B mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK
>3klt_A mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK
>3klt_C mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK
>3klt_D mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK