>3klt_D mol:protein length:72  Vimentin
PDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRR
QVQSLTCEVDALK