>3l32_B mol:protein length:45  Phosphoprotein
MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
>3l32_B mol:protein length:45  Phosphoprotein
MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
>3l32_A mol:protein length:45  Phosphoprotein
MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF