>3lzn_A mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
>3lzn_B mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
>3lzn_B mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK