>3lzp_B mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK