>3lzr_B mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
>3lzr_B mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
>3lzr_A mol:protein length:159  P19 protein
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPE
GFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELT
FYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK