>3m0a_A mol:protein length:66  TNF receptor-associated factor 2
SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQL
ERSIGLE