>3m0a_B mol:protein length:66  TNF receptor-associated factor 2
SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQL
ERSIGLE