>3mew_A mol:protein length:159  SAGA-associated factor 29 homolog
TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHAT
NKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYR
ALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC