>3mqm_B mol:protein length:126  Probable histone-lysine N-methyltransferase ASH1L
SMEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLI
TIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQ
IDEIVGET