>3mr3_T mol:na length:11  DNA (5'-D(*CP*AP*(TTD)P*AP*TP*GP*AP*CP*GP*CP*T)-3')
CATATGACGCT
>3mr3_A mol:protein length:435  DNA polymerase eta
GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARA
FGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASID
EAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQW
LDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPN
RQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGE
KNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEER
LTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSG
IQTEWSPPLTMLFLCATKFSAS
>3mr3_P mol:na length:9  DNA (5'-D(*CP*AP*GP*CP*GP*TP*CP*AP*T)-3')
CAGCGTCAT
>3mr3_P mol:na length:9  DNA (5'-D(*CP*AP*GP*CP*GP*TP*CP*AP*T)-3')
CAGCGTCAT