>3n1q_F mol:protein length:102  Cell adhesion molecule-related/down-regulated by oncogenes
GSTPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDV
VEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETK