>3n99_S mol:protein length:290  uncharacterized protein TM1086
HHHHHHGHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGD
SAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVN
HVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKI
HVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGV
GKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLVR