>3nau_B mol:protein length:66  Zinc fingers and homeoboxes protein 2
MAHHHHHHRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRC
QRGIVHI