>3nbn_Y mol:na length:37  DNA, HES1 promoter
ACTCGTGTGAAACTTCCCAAACTTTCTTTCCCACAGT
>3nbn_E mol:protein length:256  Neurogenic locus notch homolog protein 1
GMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGE
TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDL
DARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVL
LKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMH
HDIVRLLDEYNLVRSPQLHG
>3nbn_F mol:protein length:63  Mastermind-like protein 1
GLPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKR
AGKH
>3nbn_B mol:protein length:256  Neurogenic locus notch homolog protein 1
GMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGE
TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDL
DARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVL
LKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMH
HDIVRLLDEYNLVRSPQLHG
>3nbn_Y mol:na length:37  DNA, HES1 promoter
ACTCGTGTGAAACTTCCCAAACTTTCTTTCCCACAGT
>3nbn_A mol:protein length:433  Recombining binding protein suppressor of hairless
MGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGW
KKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHF
MLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTV
STRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGM
ALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKE
PNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTG
QNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPHHHHHH
>3nbn_X mol:na length:37  DNA, HES1 promoter
TACTGTGGGAAAGAAAGTTTGGAAAATTTCACACGAG
>3nbn_D mol:protein length:433  Recombining binding protein suppressor of hairless
MGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGW
KKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHF
MLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTV
STRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGM
ALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKE
PNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTG
QNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPHHHHHH
>3nbn_C mol:protein length:63  Mastermind-like protein 1
GLPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKR
AGKH