>3ncf_A mol:protein length:186  Prolactin
MLRDLFDRAVVLSHYIANLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQA
QQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLERME
LIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLK
CRIIHNNNC