>3njo_B mol:protein length:194  Abscisic acid receptor PYR1
GSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQ
TYKHFIKSCSVEQNFEMRVGCTRDVIVISGLSANTSTERLDILDDERRVTGFSIIGGEH
RLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATV
AEAMARNSGDGSGSQVT
>3njo_C mol:protein length:194  Abscisic acid receptor PYR1
GSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQ
TYKHFIKSCSVEQNFEMRVGCTRDVIVISGLSANTSTERLDILDDERRVTGFSIIGGEH
RLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATV
AEAMARNSGDGSGSQVT
>3njo_C mol:protein length:194  Abscisic acid receptor PYR1
GSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQ
TYKHFIKSCSVEQNFEMRVGCTRDVIVISGLSANTSTERLDILDDERRVTGFSIIGGEH
RLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATV
AEAMARNSGDGSGSQVT
>3njo_A mol:protein length:194  Abscisic acid receptor PYR1
GSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQ
TYKHFIKSCSVEQNFEMRVGCTRDVIVISGLSANTSTERLDILDDERRVTGFSIIGGEH
RLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATV
AEAMARNSGDGSGSQVT