>3o5z_A mol:protein length:90  Phosphatidylinositol 3-kinase regulatory subunit beta
GPLGSMAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSV
GWMPGLNERTRQRGDFPGTYVEFLGPVALAR