>3oee_1 mol:protein length:61  ATP synthase subunit epsilon
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI
TK