>3oee_I mol:protein length:61  ATP synthase subunit epsilon
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI
TK