>3oeh_Q mol:protein length:138  ATP synthase subunit delta
AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEV
MEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAR
EAAEAAIQVEVLENLQSVLK