>3oeh_R mol:protein length:61  ATP synthase subunit epsilon
SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI
TK