>3onw_D mol:protein length:36  Regulator of G-protein signaling 14
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ
>3onw_A mol:protein length:328  Guanine nucleotide-binding protein G(i) subunit alpha-1
SNAGAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAII
RAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSR
EYLLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGG
QRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDT
SIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
>3onw_D mol:protein length:36  Regulator of G-protein signaling 14
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ
>3onw_B mol:protein length:328  Guanine nucleotide-binding protein G(i) subunit alpha-1
SNAGAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAII
RAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSR
EYLLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGG
QRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDT
SIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
>3onw_C mol:protein length:36  Regulator of G-protein signaling 14
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ